LACTB2 polyclonal antibody
  • LACTB2 polyclonal antibody

LACTB2 polyclonal antibody

Ref: AB-PAB24325
LACTB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LACTB2.
Información adicional
Size 100 uL
Gene Name LACTB2
Gene Alias CGI-83
Gene Description lactamase, beta 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LACTB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51110
Iso type IgG

Enviar uma mensagem


LACTB2 polyclonal antibody

LACTB2 polyclonal antibody