GPATCH8 polyclonal antibody
  • GPATCH8 polyclonal antibody

GPATCH8 polyclonal antibody

Ref: AB-PAB24324
GPATCH8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPATCH8.
Información adicional
Size 100 uL
Gene Name GPATCH8
Gene Alias GPATC8|KIAA0553
Gene Description G patch domain containing 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SIASVFKDHAEEGTSEDGTKPDEKSSDQGLQKVGDSDGSSNLDGKKEDEDPQDGGSLASTLSKLKRMKREEGAGATEPEYYHYIPPAHCKVKPN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPATCH8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23131
Iso type IgG

Enviar uma mensagem


GPATCH8 polyclonal antibody

GPATCH8 polyclonal antibody