UAP1L1 polyclonal antibody
  • UAP1L1 polyclonal antibody

UAP1L1 polyclonal antibody

Ref: AB-PAB24321
UAP1L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UAP1L1.
Información adicional
Size 100 uL
Gene Name UAP1L1
Gene Alias -
Gene Description UDP-N-acteylglucosamine pyrophosphorylase 1-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SPNWTLDPEPRCRLWSEPRLPAGPGVLAAGSPRLPCRYVMTSEFTLGPTAEFFREHNFFHLDPANVVMFEQRLLPAVTFDGKVILER
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UAP1L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91373
Iso type IgG

Enviar uma mensagem


UAP1L1 polyclonal antibody

UAP1L1 polyclonal antibody