ARRDC1 polyclonal antibody
  • ARRDC1 polyclonal antibody

ARRDC1 polyclonal antibody

Ref: AB-PAB24316
ARRDC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARRDC1.
Información adicional
Size 100 uL
Gene Name ARRDC1
Gene Alias MGC40555
Gene Description arrestin domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IHTPRFSKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVGQALQLHADVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARRDC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92714
Iso type IgG

Enviar uma mensagem


ARRDC1 polyclonal antibody

ARRDC1 polyclonal antibody