TMEM104 polyclonal antibody
  • TMEM104 polyclonal antibody

TMEM104 polyclonal antibody

Ref: AB-PAB24314
TMEM104 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM104.
Información adicional
Size 100 uL
Gene Name TMEM104
Gene Alias FLJ00021|FLJ20255
Gene Description transmembrane protein 104
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QLHWKRMENLKEEEDDDSSTASDSDVLIRDNYERAEKRPILSVQRRGSPNPFEITDRVEMGQMASMFFNKV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM104.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54868
Iso type IgG

Enviar uma mensagem


TMEM104 polyclonal antibody

TMEM104 polyclonal antibody