LYRM5 polyclonal antibody
  • LYRM5 polyclonal antibody

LYRM5 polyclonal antibody

Ref: AB-PAB24310
LYRM5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LYRM5.
Información adicional
Size 100 uL
Gene Name LYRM5
Gene Alias -
Gene Description LYR motif containing 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LYRM5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 144363
Iso type IgG

Enviar uma mensagem


LYRM5 polyclonal antibody

LYRM5 polyclonal antibody