NUDT16L1 polyclonal antibody
  • NUDT16L1 polyclonal antibody

NUDT16L1 polyclonal antibody

Ref: AB-PAB24307
NUDT16L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NUDT16L1.
Información adicional
Size 100 uL
Gene Name NUDT16L1
Gene Alias MGC11275|SDOS
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq AVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVL
Form Liquid
Recomended Dilution Immunofluorescence (0.25-2 ug/mL)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NUDT16L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 84309
Iso type IgG

Enviar uma mensagem


NUDT16L1 polyclonal antibody

NUDT16L1 polyclonal antibody