CPSF4L polyclonal antibody
  • CPSF4L polyclonal antibody

CPSF4L polyclonal antibody

Ref: AB-PAB24293
CPSF4L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CPSF4L.
Información adicional
Size 100 uL
Gene Name CPSF4L
Gene Alias -
Gene Description cleavage and polyadenylation specific factor 4-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CPSF4L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 642843
Iso type IgG

Enviar uma mensagem


CPSF4L polyclonal antibody

CPSF4L polyclonal antibody