Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
WWC2 polyclonal antibody
Abnova
WWC2 polyclonal antibody
Ref: AB-PAB24287
WWC2 polyclonal antibody
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against recombinant WWC2.
Información adicional
Size
100 uL
Gene Name
WWC2
Gene Alias
BOMB|FLJ22029|FLJ34082
Gene Description
WW and C2 domain containing 2
Storage Conditions
Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
IHC-P
Immunogen Prot. Seq
LRVDLCSVSKHRREECLAGTQISLADLPFSSEVFTLWYNLLPSKQMPCKKNEENEDSVFQPNQPLVDSIDLDAVSALLARTSAELLAVEQELAQEEEEESG
Form
Liquid
Recomended Dilution
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Immunogen
Recombinant protein corresponding to amino acids of human WWC2.
Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID
80014
Iso type
IgG
Enviar uma mensagem
WWC2 polyclonal antibody
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*