WWC2 polyclonal antibody
  • WWC2 polyclonal antibody

WWC2 polyclonal antibody

Ref: AB-PAB24287
WWC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WWC2.
Información adicional
Size 100 uL
Gene Name WWC2
Gene Alias BOMB|FLJ22029|FLJ34082
Gene Description WW and C2 domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRVDLCSVSKHRREECLAGTQISLADLPFSSEVFTLWYNLLPSKQMPCKKNEENEDSVFQPNQPLVDSIDLDAVSALLARTSAELLAVEQELAQEEEEESG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WWC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80014
Iso type IgG

Enviar uma mensagem


WWC2 polyclonal antibody

WWC2 polyclonal antibody