C2orf51 polyclonal antibody
  • C2orf51 polyclonal antibody

C2orf51 polyclonal antibody

Ref: AB-PAB24284
C2orf51 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C2orf51.
Información adicional
Size 100 uL
Gene Name C2orf51
Gene Alias FLJ25369|TSC21
Gene Description chromosome 2 open reading frame 51
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C2orf51.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200523
Iso type IgG

Enviar uma mensagem


C2orf51 polyclonal antibody

C2orf51 polyclonal antibody