KCNK17 polyclonal antibody
  • KCNK17 polyclonal antibody

KCNK17 polyclonal antibody

Ref: AB-PAB24275
KCNK17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNK17.
Información adicional
Size 100 uL
Gene Name KCNK17
Gene Alias K2p17.1|TALK-2|TALK2|TASK-4|TASK4
Gene Description potassium channel, subfamily K, member 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq CSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNK17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 89822
Iso type IgG

Enviar uma mensagem


KCNK17 polyclonal antibody

KCNK17 polyclonal antibody