SLC35F4 polyclonal antibody
  • SLC35F4 polyclonal antibody

SLC35F4 polyclonal antibody

Ref: AB-PAB24274
SLC35F4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC35F4.
Información adicional
Size 100 uL
Gene Name SLC35F4
Gene Alias C14orf36|FLJ37712|c14_5373
Gene Description solute carrier family 35, member F4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC35F4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 341880
Iso type IgG

Enviar uma mensagem


SLC35F4 polyclonal antibody

SLC35F4 polyclonal antibody