TRIML2 polyclonal antibody
  • TRIML2 polyclonal antibody

TRIML2 polyclonal antibody

Ref: AB-PAB24273
TRIML2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRIML2.
Información adicional
Size 100 uL
Gene Name TRIML2
Gene Alias FLJ25801|MGC138164|MGC138166|SPRYD6
Gene Description tripartite motif family-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KMIESEYSMRLRLLNEECEQNLQRQQECISDLNLRETLLNQAIKLATELEEMFQEMLQRLGRVGRENMEKLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRIML2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 205860
Iso type IgG

Enviar uma mensagem


TRIML2 polyclonal antibody

TRIML2 polyclonal antibody