C6 polyclonal antibody
  • C6 polyclonal antibody

C6 polyclonal antibody

Ref: AB-PAB24272
C6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6.
Información adicional
Size 100 uL
Gene Name C6
Gene Alias -
Gene Description complement component 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 729
Iso type IgG

Enviar uma mensagem


C6 polyclonal antibody

C6 polyclonal antibody