KIAA1984 polyclonal antibody
  • KIAA1984 polyclonal antibody

KIAA1984 polyclonal antibody

Ref: AB-PAB24270
KIAA1984 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1984.
Información adicional
Size 100 uL
Gene Name KIAA1984
Gene Alias MGC15438|PARF|RP11-216L13.9|bA216L13.7
Gene Description KIAA1984
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QELLLTIQMGIDNLYVRLMGITLPATQREVVLSNTLDLNSKLAYCEGKLTYLADRVQMVSRTEEGDTKVRDTLESSTLMEKYNTRISFENRE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1984.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84960
Iso type IgG

Enviar uma mensagem


KIAA1984 polyclonal antibody

KIAA1984 polyclonal antibody