FAM168B polyclonal antibody
  • FAM168B polyclonal antibody

FAM168B polyclonal antibody

Ref: AB-PAB24267
FAM168B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM168B.
Información adicional
Size 100 uL
Gene Name FAM168B
Gene Alias MGC87527
Gene Description family with sequence similarity 168, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM168B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 130074
Iso type IgG

Enviar uma mensagem


FAM168B polyclonal antibody

FAM168B polyclonal antibody