FXYD6 polyclonal antibody
  • FXYD6 polyclonal antibody

FXYD6 polyclonal antibody

Ref: AB-PAB24172
FXYD6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FXYD6.
Información adicional
Size 100 uL
Gene Name FXYD6
Gene Alias -
Gene Description FXYD domain containing ion transport regulator 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SRRCKCSFNQKPRAPGDEEAQVENLITANATEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FXYD6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 53826
Iso type IgG

Enviar uma mensagem


FXYD6 polyclonal antibody

FXYD6 polyclonal antibody