AP5Z1 polyclonal antibody
  • AP5Z1 polyclonal antibody

AP5Z1 polyclonal antibody

Ref: AB-PAB24124
AP5Z1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AP5Z1.
Información adicional
Size 100 uL
Gene Name AP5Z1
Gene Alias tcag7.1310|KIAA0415|SPG48|zeta
Gene Description adaptor-related protein complex 5, zeta 1 subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DDQWLNVQAFSMLRAWLLHSGPEGPGTLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AP5Z1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9907
Iso type IgG

Enviar uma mensagem


AP5Z1 polyclonal antibody

AP5Z1 polyclonal antibody