USP37 polyclonal antibody
  • USP37 polyclonal antibody

USP37 polyclonal antibody

Ref: AB-PAB24096
USP37 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant USP37.
Información adicional
Size 100 uL
Gene Name USP37
Gene Alias KIAA1594|MGC117261
Gene Description ubiquitin specific peptidase 37
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNVVLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLPAAMKPSQGSGSFGAILGSRTSQKETSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human USP37.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57695
Iso type IgG

Enviar uma mensagem


USP37 polyclonal antibody

USP37 polyclonal antibody