INSM2 polyclonal antibody
  • INSM2 polyclonal antibody

INSM2 polyclonal antibody

Ref: AB-PAB24091
INSM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant INSM2.
Información adicional
Size 100 uL
Gene Name INSM2
Gene Alias IA-6|mlt1
Gene Description insulinoma-associated 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KHLSTHEAGSARALAPGFGSERGAPLAFACPLCGAHFPTADIREKHRLWHAVREELLLPALAGAPPETSGPSGPSDGSAQQIFSCKHCPSTF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human INSM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84684
Iso type IgG

Enviar uma mensagem


INSM2 polyclonal antibody

INSM2 polyclonal antibody