FAM76A polyclonal antibody
  • FAM76A polyclonal antibody

FAM76A polyclonal antibody

Ref: AB-PAB24087
FAM76A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM76A.
Información adicional
Size 100 uL
Gene Name FAM76A
Gene Alias FLJ41946|MGC34648
Gene Description family with sequence similarity 76, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM76A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 199870
Iso type IgG

Enviar uma mensagem


FAM76A polyclonal antibody

FAM76A polyclonal antibody