GLRA4 polyclonal antibody
  • GLRA4 polyclonal antibody

GLRA4 polyclonal antibody

Ref: AB-PAB24086
GLRA4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GLRA4.
Información adicional
Size 100 uL
Gene Name GLRA4
Gene Alias -
Gene Description glycine receptor, alpha 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IRLRRRQRRQRLEEDIIQESRFYFRGYGLGHCLQARDGGPMEGSGIYSPQPPAPLLREGETTRKLYVD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GLRA4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 441509
Iso type IgG

Enviar uma mensagem


GLRA4 polyclonal antibody

GLRA4 polyclonal antibody