TBC1D24 polyclonal antibody
  • TBC1D24 polyclonal antibody

TBC1D24 polyclonal antibody

Ref: AB-PAB24084
TBC1D24 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TBC1D24.
Información adicional
Size 100 uL
Gene Name TBC1D24
Gene Alias KIAA1171|MGC102885
Gene Description TBC1 domain family, member 24
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RGKVYQRLIRDIPCRTVTPDASVYSDIVGKIVGKHSSSCLPLPEFVDNTQVPSYCLNARGEGAVRKILLCLANQFPD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBC1D24.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57465
Iso type IgG

Enviar uma mensagem


TBC1D24 polyclonal antibody

TBC1D24 polyclonal antibody