CHSY3 polyclonal antibody
  • CHSY3 polyclonal antibody

CHSY3 polyclonal antibody

Ref: AB-PAB24080
CHSY3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHSY3.
Información adicional
Size 100 uL
Gene Name CHSY3
Gene Alias CHSY2|CSS3
Gene Description chondroitin sulfate synthase 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHSY3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 337876
Iso type IgG

Enviar uma mensagem


CHSY3 polyclonal antibody

CHSY3 polyclonal antibody