TMEM161B polyclonal antibody
  • TMEM161B polyclonal antibody

TMEM161B polyclonal antibody

Ref: AB-PAB24074
TMEM161B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM161B.
Información adicional
Size 100 uL
Gene Name TMEM161B
Gene Alias FLB3342|MGC33214|PRO1313
Gene Description transmembrane protein 161B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TLGNHSWGIYPESISTLPVDNSLLSNSVYSELPSAEGKMKVTVTQITVALSSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM161B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 153396
Iso type IgG

Enviar uma mensagem


TMEM161B polyclonal antibody

TMEM161B polyclonal antibody