SPIN4 polyclonal antibody
  • SPIN4 polyclonal antibody

SPIN4 polyclonal antibody

Ref: AB-PAB24072
SPIN4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPIN4.
Información adicional
Size 100 uL
Gene Name SPIN4
Gene Alias FLJ44984|MGC133224
Gene Description spindlin family, member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPIN4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 139886
Iso type IgG

Enviar uma mensagem


SPIN4 polyclonal antibody

SPIN4 polyclonal antibody