FBRS polyclonal antibody
  • FBRS polyclonal antibody

FBRS polyclonal antibody

Ref: AB-PAB24061
FBRS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FBRS.
Información adicional
Size 100 uL
Gene Name FBRS
Gene Alias FBS|FBS1|FLJ11618
Gene Description fibrosin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTH
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FBRS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64319
Iso type IgG

Enviar uma mensagem


FBRS polyclonal antibody

FBRS polyclonal antibody