C1orf123 polyclonal antibody
  • C1orf123 polyclonal antibody

C1orf123 polyclonal antibody

Ref: AB-PAB24060
C1orf123 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf123.
Información adicional
Size 100 uL
Gene Name C1orf123
Gene Alias FLJ20580
Gene Description chromosome 1 open reading frame 123
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IALQLKATLENITNLRPVGEDFRWYLKMKCGNCGEISDKWQYIRLMDSVALKGGRGSASMVQKCKLCARE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf123.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54987
Iso type IgG

Enviar uma mensagem


C1orf123 polyclonal antibody

C1orf123 polyclonal antibody