FAM151B polyclonal antibody
  • FAM151B polyclonal antibody

FAM151B polyclonal antibody

Ref: AB-PAB24058
FAM151B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM151B.
Información adicional
Size 100 uL
Gene Name FAM151B
Gene Alias UNQ9217
Gene Description family with sequence similarity 151, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MAASAGGPGSWSENILEYFLRNSQITAEDGAEITWYHAANHKAQTNEALKSTAHMIEADVLLPSDGSEHSQPIMAHPPETNSDNTLQEWLTEVMK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM151B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 167555
Iso type IgG

Enviar uma mensagem


FAM151B polyclonal antibody

FAM151B polyclonal antibody