RBM42 polyclonal antibody
  • RBM42 polyclonal antibody

RBM42 polyclonal antibody

Ref: AB-PAB24050
RBM42 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM42.
Información adicional
Size 100 uL
Gene Name RBM42
Gene Alias MGC10433
Gene Description RNA binding motif protein 42
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM42.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79171
Iso type IgG

Enviar uma mensagem


RBM42 polyclonal antibody

RBM42 polyclonal antibody