CCDC69 polyclonal antibody
  • CCDC69 polyclonal antibody

CCDC69 polyclonal antibody

Ref: AB-PAB24048
CCDC69 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC69.
Información adicional
Size 100 uL
Gene Name CCDC69
Gene Alias DKFZp434C171|FLJ13705
Gene Description coiled-coil domain containing 69
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq THSFREASSTQQETIDRLTSQLEAFQAKMKRVEESILSRNYKKHIQDYGSPSQFWEQELESLHFVIEMKNERIHELDRRLILMETV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC69.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26112
Iso type IgG

Enviar uma mensagem


CCDC69 polyclonal antibody

CCDC69 polyclonal antibody