DNAJC16 polyclonal antibody
  • DNAJC16 polyclonal antibody

DNAJC16 polyclonal antibody

Ref: AB-PAB24047
DNAJC16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAJC16.
Información adicional
Size 100 uL
Gene Name DNAJC16
Gene Alias DKFZp686G1298|DKFZp686N0387|DKFZp781I1547|KIAA0962
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TKTSLLQKFALEVYTFTGSSCLHFSFLSLDKHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTGYVLALNGHKKYFCLFKPQKTVEEEEAIGSCSDVDSSLYLGESRGKPSCGLGSRPIKGKLSKLSLWMER
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAJC16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23341
Iso type IgG

Enviar uma mensagem


DNAJC16 polyclonal antibody

DNAJC16 polyclonal antibody