FAM160B1 polyclonal antibody
  • FAM160B1 polyclonal antibody

FAM160B1 polyclonal antibody

Ref: AB-PAB24046
FAM160B1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM160B1.
Información adicional
Size 100 uL
Gene Name FAM160B1
Gene Alias DKFZp686D10123|KIAA1600|bA106M7.3
Gene Description family with sequence similarity 160, member B1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq CGEVLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSLASKGVPNVISEDTLKGQDSLSTDTGQSRQPEELSGATGMEQTELEDEPPHQMDHL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM160B1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57700
Iso type IgG

Enviar uma mensagem


FAM160B1 polyclonal antibody

FAM160B1 polyclonal antibody