C4orf27 polyclonal antibody
  • C4orf27 polyclonal antibody

C4orf27 polyclonal antibody

Ref: AB-PAB24041
C4orf27 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C4orf27.
Información adicional
Size 100 uL
Gene Name C4orf27
Gene Alias FLJ20534|FLJ33423|FLJ42042
Gene Description chromosome 4 open reading frame 27
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQYHMGYFRDSPDEFPVYVGINEAKKNCIIVPNGDNVFAA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C4orf27.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54969
Iso type IgG

Enviar uma mensagem


C4orf27 polyclonal antibody

C4orf27 polyclonal antibody