FAM70B polyclonal antibody
  • FAM70B polyclonal antibody

FAM70B polyclonal antibody

Ref: AB-PAB24033
FAM70B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM70B.
Información adicional
Size 100 uL
Gene Name FAM70B
Gene Alias MGC20579|RP11-199F6.1
Gene Description family with sequence similarity 70, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VPLSQLAYGPAVPPQTLYNPAQQILAYAGFRLTPEPVPTCSSYPLPLQPCSRFPVAPSSALASSEDLQPPSPSSSGSGLPGQAPPCYAP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM70B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 348013
Iso type IgG

Enviar uma mensagem


FAM70B polyclonal antibody

FAM70B polyclonal antibody