C3orf62 polyclonal antibody
  • C3orf62 polyclonal antibody

C3orf62 polyclonal antibody

Ref: AB-PAB24031
C3orf62 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C3orf62.
Información adicional
Size 100 uL
Gene Name C3orf62
Gene Alias FLJ43654|MGC23381|MGC61663|MGC62079
Gene Description chromosome 3 open reading frame 62
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CAPENENPAFATNHAPVNAKPHALCPERKPLTSKENVLMHSSILAPERESWRTAGEGENWRKENLRKDMERDLKADSNMPLNNSSQEVTKDLLDMIDH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C3orf62.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375341
Iso type IgG

Enviar uma mensagem


C3orf62 polyclonal antibody

C3orf62 polyclonal antibody