FAM129C polyclonal antibody
  • FAM129C polyclonal antibody

FAM129C polyclonal antibody

Ref: AB-PAB24027
FAM129C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM129C.
Información adicional
Size 100 uL
Gene Name FAM129C
Gene Alias BCNP1|FLJ39802
Gene Description family with sequence similarity 129, member C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HKEEYENGGHCLGSTALTGYTLLTSQREYLRLLDALCPESLGDHTQEEPDSLLEVPVSFPLFLQHPFRRHLCFSAATR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM129C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 199786
Iso type IgG

Enviar uma mensagem


FAM129C polyclonal antibody

FAM129C polyclonal antibody