IRGQ polyclonal antibody
  • IRGQ polyclonal antibody

IRGQ polyclonal antibody

Ref: AB-PAB24025
IRGQ polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IRGQ.
Información adicional
Size 100 uL
Gene Name IRGQ
Gene Alias FKSG27|FLJ12521|FLJ38849|FLJ42796|FLJ46713|IRGQ1
Gene Description immunity-related GTPase family, Q
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PPGLGKSALIAALCDKDVETLEAPEGRPDSGVPSLRAAGPGLFLGELSCPPAAPGPWAAEANVLVLVLPGPEGNGEPLAPAL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IRGQ.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 126298
Iso type IgG

Enviar uma mensagem


IRGQ polyclonal antibody

IRGQ polyclonal antibody