ARHGAP19 polyclonal antibody
  • ARHGAP19 polyclonal antibody

ARHGAP19 polyclonal antibody

Ref: AB-PAB24023
ARHGAP19 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARHGAP19.
Información adicional
Size 100 uL
Gene Name ARHGAP19
Gene Alias DKFZp313K217|MGC138804|MGC138805|MGC14258
Gene Description Rho GTPase activating protein 19
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKLLLDLLYQTAKKQDKNKMSAYNLALMF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARHGAP19.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84986
Iso type IgG

Enviar uma mensagem


ARHGAP19 polyclonal antibody

ARHGAP19 polyclonal antibody