TMEM196 polyclonal antibody
  • TMEM196 polyclonal antibody

TMEM196 polyclonal antibody

Ref: AB-PAB24017
TMEM196 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM196.
Información adicional
Size 100 uL
Gene Name TMEM196
Gene Alias DKFZp686H19205|DKFZp686K0753|MGC42090
Gene Description transmembrane protein 196
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LTCRLASYEQRRMFSEREHSLHHSHEMAEKEITDNMSNGGPQLIFNGRV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM196.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 256130
Iso type IgG

Enviar uma mensagem


TMEM196 polyclonal antibody

TMEM196 polyclonal antibody