TMEM30B polyclonal antibody
  • TMEM30B polyclonal antibody

TMEM30B polyclonal antibody

Ref: AB-PAB24016
TMEM30B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM30B.
Información adicional
Size 100 uL
Gene Name TMEM30B
Gene Alias CDC50B|MGC126775
Gene Description transmembrane protein 30B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GIKELEYDYTGDPGTGNCSVCAAAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNEC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM30B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 161291
Iso type IgG

Enviar uma mensagem


TMEM30B polyclonal antibody

TMEM30B polyclonal antibody