INO80E polyclonal antibody
  • INO80E polyclonal antibody

INO80E polyclonal antibody

Ref: AB-PAB24015
INO80E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant INO80E.
Información adicional
Size 100 uL
Gene Name INO80E
Gene Alias CCDC95|FLJ00079|FLJ90652
Gene Description INO80 complex subunit E
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human INO80E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283899
Iso type IgG

Enviar uma mensagem


INO80E polyclonal antibody

INO80E polyclonal antibody