C5orf22 polyclonal antibody
  • C5orf22 polyclonal antibody

C5orf22 polyclonal antibody

Ref: AB-PAB24005
C5orf22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C5orf22.
Información adicional
Size 100 uL
Gene Name C5orf22
Gene Alias DKFZp667N066|FLJ11193|FLJ23805|MGC33010
Gene Description chromosome 5 open reading frame 22
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IWFHPTWAQQIREGRHHFLVGKDTSTTTIRVTSTDHYFLSDGLYVPEDQLENQKPLQLDVIMVKPYKLCNNQEENDAVSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C5orf22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55322
Iso type IgG

Enviar uma mensagem


C5orf22 polyclonal antibody

C5orf22 polyclonal antibody