TRAPPC6A polyclonal antibody
  • TRAPPC6A polyclonal antibody

TRAPPC6A polyclonal antibody

Ref: AB-PAB24001
TRAPPC6A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRAPPC6A.
Información adicional
Size 100 uL
Gene Name TRAPPC6A
Gene Alias HSPC289|MGC2650|TRS33
Gene Description trafficking protein particle complex 6A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRAPPC6A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79090
Iso type IgG

Enviar uma mensagem


TRAPPC6A polyclonal antibody

TRAPPC6A polyclonal antibody