RPS19BP1 polyclonal antibody
  • RPS19BP1 polyclonal antibody

RPS19BP1 polyclonal antibody

Ref: AB-PAB23995
RPS19BP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPS19BP1.
Información adicional
Size 100 uL
Gene Name RPS19BP1
Gene Alias AROS|FLJ21770|MGC52010|S19BP|dJ1104E15.4
Gene Description ribosomal protein S19 binding protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq CRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPS19BP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91582
Iso type IgG

Enviar uma mensagem


RPS19BP1 polyclonal antibody

RPS19BP1 polyclonal antibody