ZNF837 polyclonal antibody
  • ZNF837 polyclonal antibody

ZNF837 polyclonal antibody

Ref: AB-PAB23992
ZNF837 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF837.
Información adicional
Size 100 uL
Gene Name ZNF837
Gene Alias -
Gene Description zinc finger protein 837
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq CPRTPKPTSRGRNPLVEQPRACACGEAFAWRALRIPQERLQATEEPRPCARCGKRFRPNQQQQTGKSPPVCPECGQTSRPRPIVPDPPAQRLYACDE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF837.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116412
Iso type IgG

Enviar uma mensagem


ZNF837 polyclonal antibody

ZNF837 polyclonal antibody