CNEP1R1 polyclonal antibody
  • CNEP1R1 polyclonal antibody

CNEP1R1 polyclonal antibody

Ref: AB-PAB23989
CNEP1R1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNEP1R1.
Información adicional
Size 100 uL
Gene Name CNEP1R1
Gene Alias C16orf69|NEP1-R1|TMEM188|TMP125
Gene Description CTD nuclear envelope phosphatase 1 regulatory subunit 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRSVLLHII
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CNEP1R1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 255919
Iso type IgG

Enviar uma mensagem


CNEP1R1 polyclonal antibody

CNEP1R1 polyclonal antibody