FAM55D polyclonal antibody
  • FAM55D polyclonal antibody

FAM55D polyclonal antibody

Ref: AB-PAB23986
FAM55D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM55D.
Información adicional
Size 100 uL
Gene Name FAM55D
Gene Alias C11orf33|FLJ20127
Gene Description family with sequence similarity 55, member D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LSKQEKSLFERSNVGVEIMEKFNTISVSKCNKETVAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM55D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54827
Iso type IgG

Enviar uma mensagem


FAM55D polyclonal antibody

FAM55D polyclonal antibody