GPR123 polyclonal antibody
  • GPR123 polyclonal antibody

GPR123 polyclonal antibody

Ref: AB-PAB23978
GPR123 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPR123.
Información adicional
Size 100 uL
Gene Name GPR123
Gene Alias FLJ25875|FLJ37356
Gene Description G protein-coupled receptor 123
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PCKMTNLQAAQGHASCLSPATPCCAKMHCEPLTADEAHVHLQEEGAFGHDPHLHGCLQGRTKPPYFSRHPAEEPEYAYHIPSSLDGSPRSSRTDSPPSSLDG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPR123.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84435
Iso type IgG

Enviar uma mensagem


GPR123 polyclonal antibody

GPR123 polyclonal antibody