ANKRD27 polyclonal antibody
  • ANKRD27 polyclonal antibody

ANKRD27 polyclonal antibody

Ref: AB-PAB23977
ANKRD27 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD27.
Información adicional
Size 100 uL
Gene Name ANKRD27
Gene Alias DKFZp434L0718|FLJ00040|PP12899|VARP
Gene Description ankyrin repeat domain 27 (VPS9 domain)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MALYDEDLLKNPFYLALQKCRPDLCSKVAQIHGIVLVPCKGSLSSSIQSTCQFESYILIPVEEHFQTLNGKDVFIQGNRIKLGAGFACLLSVPILFEETFYNEKEESFSILCI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD27.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84079
Iso type IgG

Enviar uma mensagem


ANKRD27 polyclonal antibody

ANKRD27 polyclonal antibody